PDB entry 1eba

View 1eba on RCSB PDB site
Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)
Class: signaling protein
Keywords: erythropoietin receptor, signal transduction, protein minimization, drug design, cytokine receptor class 1, complex (cytokine receptor/peptide), signaling protein
Deposited on 1998-10-02, released 1998-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ebaa1, d1ebaa2
  • Chain 'B':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ebab1, d1ebab2
  • Chain 'C':
    Compound: protein (epo mimetics peptide 33)
    Database cross-references and differences (RAF-indexed):
    • PDB 1EBA
  • Chain 'D':
    Compound: protein (epo mimetics peptide 33)
    Database cross-references and differences (RAF-indexed):
    • PDB 1EBA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ebaA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltpsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebaA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsaggsvqrveilegrtecvlsnlrgrtry
    tfavrarmaepsfggfwsawsepvslltpsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ebaB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltpsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebaB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rlasghvvlrwlpppetpmtshiryevdvsagngsvqrveilegrtecvlsnlrgrtryt
    favrarmaepsfggfwsawsepvsllt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.