PDB entry 1eba

View 1eba on RCSB PDB site
Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)
Deposited on 1998-10-02, released 1998-11-11
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ebaA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltpsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebaA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsaggsvqrveilegrtecvlsnlrgrtry
    tfavrarmaepsfggfwsawsepvslltpsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ebaB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvsllt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebaB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rlasghvvlrwlpppetpmtshiryevdvsagngsvqrveilegrtecvlsnlrgrtryt
    favrarmaepsfggfwsawsepvsllt