PDB entry 1eb9

View 1eb9 on RCSB PDB site
Description:
Deposited on 2001-07-24, released 2002-01-01
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-01, with a file datestamp of 2002-01-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1eb9a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1eb9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb9A (A:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb9B (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya