PDB entry 1eb8

View 1eb8 on RCSB PDB site
Description: structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Class: lyase
Keywords: hydroxynitrile lyase, substrate specificity, active-site tunnel mutant, lyase
Deposited on 2001-07-24, released 2002-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (s)-acetone-cyanohydrin lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1EB8 (0-4)
      • engineered mutation (131)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1eb8a1, d1eb8a2
  • Chain 'B':
    Compound: (s)-acetone-cyanohydrin lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1EB8 (Start-4)
      • engineered mutation (131)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1eb8b1, d1eb8b2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb8A (A:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eb8B (B:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eb8B (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya