PDB entry 1eb7

View 1eb7 on RCSB PDB site
Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
Deposited on 2001-07-24, released 2001-07-24
The last revision prior to the SCOP 1.61 freeze date was dated 2001-07-24, with a file datestamp of 2001-07-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.172
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eb7A (A:)
    dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
    gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
    lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlvtpdspfdlylkgddka
    ldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasvlpsgdkgrfavtktqs
    deyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddvenivaflhsls
    gkqprveypllpastettprpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eb7A (A:)
    dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
    gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
    lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlvtpdspfdlylkgddka
    ldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdadkgrfavtktqsdeyvfr
    aaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddvenivaflhslsgkqprv
    eypllpastettprpae