PDB entry 1eb4

View 1eb4 on RCSB PDB site
Description: histidine ammonia-lyase (hal) mutant f329a from pseudomonas putida
Class: lyase
Keywords: lyase, ammonia-lyase, histidine degradation
Deposited on 2001-07-19, released 2002-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida [TaxId:303]
    Gene: HUTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (328)
      • chromophore (141)
    Domains in SCOPe 2.07: d1eb4a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb4A (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnahaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl