PDB entry 1eb3

View 1eb3 on RCSB PDB site
Description: yeast 5-aminolaevulinic acid dehydratase 4,7-dioxosebacic acid complex
Class: dehydratase
Keywords: dehydratase, aldolase, tim barrel, tetrapyrrole synthesis
Deposited on 2001-07-18, released 2001-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-aminolaevulinic acid dehydratase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eb3a_
  • Heterogens: DSB, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb3A (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshqgflragarliitylapefldwlde