PDB entry 1eaz

View 1eaz on RCSB PDB site
Description: crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Class: lipid-binding protein
Keywords: lipid-binding protein, lipid degradation, ph domain, phosphatidylinositol (3, 4)-bisphosphate, signalling
Deposited on 2001-07-17, released 2002-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.171
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tandem ph domain containing protein-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaza_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eazA (A:)
    gsmftpkppqdsavikagycvkqgavmknwkrryfqldentigyfkselekeplrviplk
    evhkvqeckqsdimmrdnlfeivttsrtfyvqadspeemhswikavsgaivaqrgpgrsa
    ssehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eazA (A:)
    savikagycvkqgavmknwkrryfqldentigyfkselekeplrviplkevhkvqeckqs
    dimmrdnlfeivttsrtfyvqadspeemhswikavsgaivaqrg