PDB entry 1eav

View 1eav on RCSB PDB site
Description: crystal structures of human gephyrin and plant cnx1 g domains - comparative analysis and functional implications
Class: molybdenum cofactor biosynthesis
Keywords: molybdenum cofactor biosynthesis, cnx1g
Deposited on 2001-07-17, released 2001-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eava_
  • Chain 'B':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavb_
  • Chain 'C':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavc_
  • Chain 'D':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavd_
  • Chain 'E':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eave_
  • Chain 'F':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavf_
  • Chain 'G':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavg_
  • Chain 'H':
    Compound: molybdopterin biosynthesis cnx1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-161)
      • modified residue (71)
      • modified residue (107-108)
      • modified residue (119)
      • modified residue (136)
      • modified residue (147)
    Domains in SCOPe 2.07: d1eavh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eavA (A:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavA (A:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eavB (B:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavB (B:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eavC (C:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavC (C:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eavD (D:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavD (D:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eavE (E:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavE (E:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eavF (F:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavF (F:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1eavG (G:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavG (G:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1eavH (H:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eavH (H:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqi