PDB entry 1ear

View 1ear on RCSB PDB site
Description: Crystal structure of Bacillus pasteurii UreE at 1.7 A. Type II crystal form.
Class: chaperone
Keywords: chaperone, putative ni-chaperone, urease operon
Deposited on 2001-07-16, released 2002-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease accessory protein uree
    Species: BACILLUS PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50049 (0-End)
      • cloning artifact (1)
      • cloning artifact (12-16)
    Domains in SCOPe 2.08: d1eara1, d1eara2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1earA (A:)
    mvitkivghiddlshqikkvdwlevewedlnkrilrketengtdiaiklensgtlrygdv
    lyesddtliairtklekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktlek
    lidevgvsyeqserrfkepfkyrghqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1earA (A:)
    mvitkivghiddlshqikkvdwlevewedlnkrilrketengtdiaiklensgtlrygdv
    lyesddtliairtklekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktlek
    lidevgvsyeqserrfkepfky