PDB entry 1eap

View 1eap on RCSB PDB site
Description: crystal structure of a catalytic antibody with a serine protease active site
Class: catalytic antibody
Keywords: catalytic antibody
Deposited on 1994-08-10, released 1994-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2b-kappa 17e8 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43420 (2-212)
      • conflict (3)
      • conflict (21)
      • conflict (25)
      • conflict (29)
      • conflict (33)
      • conflict (54)
      • conflict (62)
      • conflict (79-80)
      • conflict (91)
      • conflict (154-155)
      • conflict (185)
    Domains in SCOPe 2.06: d1eapa1, d1eapa2
  • Chain 'B':
    Compound: igg2b-kappa 17e8 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EAP (0-215)
    Domains in SCOPe 2.06: d1eapb1, d1eapb2
  • Heterogens: HEP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eapA (A:)
    dieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkgprllihytstllpgips
    rfrgsgsgrdysfsisnleggdiatyyclqyynlrtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgseraqgvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eapB (B:)
    evqlqesgtelvkpgasvkisckasgyistdhaihwvkqrpeqglewigyispgngdiky
    nekfkvkatltadqssstaymqlnsltsedsavyfckrsyygssyvdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgglsssvhtfpallqsgl
    ytmsssvtvpgggwpsatvtcsvahpassttvdkkl