PDB entry 1eao

View 1eao on RCSB PDB site
Description: THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound chloride ions modulate DNA binding
Class: transcription/DNA
Keywords: TRANSCRIPTION/DNA, ACUTE MYELOID LEUKEMIA, AML, RUNX1, RUNT DOMAIN, CHLORIDE BINDING, TRANSCRIPTION FACTOR, IG FOLD, TRANSCRIPTION-DNA complex
Deposited on 2001-07-14, released 2002-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: runt-related transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03347
      • engineered mutation (26)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d1eaoa_
  • Chain 'B':
    Compound: runt-related transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03347
      • engineered mutation (26)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d1eaob_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eaoA (A:)
    sgdrsmvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtv
    magndenysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhra
    ikitvdgpreprrhrqkldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eaoA (A:)
    smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eaoB (B:)
    sgdrsmvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtv
    magndenysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhra
    ikitvdgpreprrhrqkldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eaoB (B:)
    smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgp