PDB entry 1ean

View 1ean on RCSB PDB site
Description: THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound chloride ions modulate DNA binding
Class: transcription/DNA
Keywords: transcription-DNA complex, acute myeloid leukemia, aml, runx1, runt domain, chloride binding, transcription factor, ig fold
Deposited on 2001-07-13, released 2002-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: runt-related transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03347
      • engineered mutation (26)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d1eana_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eanA (A:)
    sgdrsmvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtv
    magndenysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhra
    ikitvdgpreprrhrqkldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eanA (A:)
    gelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
    ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp