PDB entry 1eam

View 1eam on RCSB PDB site
Description: vaccinia methyltransferase vp39 mutant (ec: 2.7.7.19)
Class: transferase
Keywords: methylated guanosine, methyltransferase mutant e233a, poly (a) polymerase, vaccinia, mRNA processing, transcription, transferase
Deposited on 1999-01-26, released 1999-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (vp39)
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07617 (0-End)
      • engineered (232)
    Domains in SCOPe 2.07: d1eama_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eamA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
    pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyakkmyyln
    kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflniptts
    tekvshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eamA (A:)
    mdvvsldkpfmyfeeidneldyepakklpyqgqlklllgelfflsklqrhgildgatvvy
    igsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylrsikk
    qlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfyiph
    gnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyakkmyylnkivrnkvvvnfd
    ypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip