PDB entry 1eal

View 1eal on RCSB PDB site
Description: nmr study of ileal lipid binding protein
Class: fatty acid binding protein
Keywords: intracellular lipid binding protein, bile acid binding, ileal epithelium, fatty acid binding protein
Deposited on 1996-08-28, released 1997-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ileal lipid binding protein
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10289 (0-126)
    • conflict (117)
  Domains in SCOPe 2.08: d1eala_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ealA (A:)
  aftgkyeieseknydefmkrlalpsdaidkarnlkiisevkqdgqnftwsqqypgghsit
  ntftigkecdietiggkkfkatvqmeggkvvvnspnyhhtaeivdgklvevstvggvsye
  rvskkla