PDB entry 1eaj

View 1eaj on RCSB PDB site
Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain at 1.35 angstrom resolution
Class: virus/viral protein receptor
Keywords: virus/viral protein receptor, immunoglobulin v domain fold, symmetric dimer
Deposited on 2001-07-12, released 2001-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.13708
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coxsackie virus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaja_
  • Chain 'B':
    Compound: coxsackie virus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eajb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eajA (A:)
    dfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviily
    sgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkih
    lvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eajA (A:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eajB (B:)
    dfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviily
    sgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkih
    lvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eajB (B:)
    lsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdki
    yddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlv