PDB entry 1eai

View 1eai on RCSB PDB site
Description: complex of ascaris chymotrpsin/elastase inhibitor with porcine elastase
Class: serine proteinase
Keywords: serine proteinase, elastase, ascaris summ, protein inhibitor
Deposited on 1999-03-25, released 1999-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (elastase)
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaia_
  • Chain 'B':
    Compound: protein (elastase)
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaib_
  • Chain 'C':
    Compound: protein (chymotrypsin/elastase isoinhibitor 1)
    Species: Ascaris suum [TaxId:6253]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaic_
  • Chain 'D':
    Compound: protein (chymotrypsin/elastase isoinhibitor 1)
    Species: Ascaris suum [TaxId:6253]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eaiA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eaiB (B:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eaiC (C:)
    gqescgpnevwtectgcemkcgpdentpcplmcrrpscecspgrgmrrtndgkcipasqc
    p
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eaiD (D:)
    gqescgpnevwtectgcemkcgpdentpcplmcrrpscecspgrgmrrtndgkcipasqc
    p