PDB entry 1eah

View 1eah on RCSB PDB site
Description: pv2l complexed with antiviral agent sch48973
Class: Virus
Keywords: TYPE 2, LANSING, ANTIVIRAL, PICORNAVIRUS, MOUSE NEUROVIRULENCE, COAT PROTEIN, Icosahedral virus
Deposited on 1997-07-22, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: poliovirus type 2 coat proteins vp1 to vp4
    Species: Human poliovirus 2 [TaxId:12083]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eah1_
  • Chain '2':
    Compound: poliovirus type 2 coat proteins vp1 to vp4
    Species: Human poliovirus 2 [TaxId:12083]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06210 (Start-270)
      • conflict (10)
    Domains in SCOPe 2.07: d1eah.1
  • Chain '3':
    Compound: poliovirus type 2 coat proteins vp1 to vp4
    Species: Human poliovirus 2 [TaxId:12083]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eah3_
  • Chain '4':
    Compound: poliovirus type 2 coat proteins vp1 to vp4
    Species: Human poliovirus 2 [TaxId:12083]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eah.1
  • Heterogens: MYR, SC4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1eah1 (1:)
    glgdliegvvegvtrnaltpltpannlpdtqssgpahsketpaltavetgatnplvpsdt
    vqtrhviqkrtrsestvesffargacvaiievdndaptkrasklfsvwkitykdtvqlrr
    klefftysrfdmeftfvvtsnytdannghalnqvyqimyippgapipgkwndytwqtssn
    psvfytygapparisvpyvgianayshfydgfakvplagqastegdslygaaslndfgsl
    avrvvndhnptkltskirvymkpkhvrvwcprppravpyygpgvdykdglaplpgkgltt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eah1 (1:)
    annlpdtqssgpahsketpaltavetgatnplvpsdtvqtrhviqkrtrsestvesffar
    gacvaiievdndsklfsvwkitykdtvqlrrklefftysrfdmeftfvvtsnytdanngh
    alnqvyqimyippgapipgkwndytwqtssnpsvfytygapparisvpyvgianayshfy
    dgfakvplagqastegdslygaaslndfgslavrvvndhnptkltskirvymkpkhvrvw
    cprppravpyygpgvdykdglaplpgkgltty
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1eah2 (2:)
    spnieacgysvrvmqltlgnstittqeaansvvaygrwpeyikdseanpvdqptepdvaa
    crfytldtvtwrkesrgwwwklpdalkdmglfgqnmfyhylgragytvhvqcnaskfhqg
    algvfavpemclagdstthmftkyenanpgekggefkgsftldtnatnparnfcpvdylf
    gsgvlagnafvyphqiinlrtnncatlvlpyvnslsidsmtkhnnwgiailplapldfat
    essteipitltiapmccefnglrnitvprtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eah2 (2:)
    svrvmqltlgnstittqeaansvvaygrwpeyikdseanpvdqptepdvaacrfytldtv
    twrkesrgwwwklpdalkdmglfgqnmfyhylgragytvhvqcnaskfhqgalgvfavpe
    mclagdstthmftkyenanpgekggefkgsftldtnatnparnfcpvdylfgsgvlagna
    fvyphqiinlrtnncatlvlpyvnslsidsmtkhnnwgiailplapldfatessteipit
    ltiapmccefnglrnitvprtq
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1eah3 (3:)
    glpvlntpgsnqyltadnyqspcaipefdvtppidipgevrnmmelaeidtmiplnltnq
    rkntmdmyrvelndaahsdtpilclslspasdprlahtmlgeilnyythwagslkftflf
    cgsmmatgkllvsyappgaeapksrkeamlgthviwdiglqssctmvvpwisnttyrqti
    ndsfteggyismfyqtrvvvplstprkmdilgfvsacndfsvrllrdtthisqeampq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eah3 (3:)
    glpvlntpgsnqyltadnyqspcaipefdvtppidipgevrnmmelaeidtmiplnltnq
    rkntmdmyrvelndaahsdtpilclslspasdprlahtmlgeilnyythwagslkftflf
    cgsmmatgkllvsyappgaeapksrkeamlgthviwdiglqssctmvvpwisnttyrqti
    ndsfteggyismfyqtrvvvplstprkmdilgfvsacndfsvrllrdtthisqea
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eah4 (4:)
    gaqvssqkvgahensnrayggstinyttinyyrdsasnaaskqdfaqdpskftepikdvl
    iktaptln