PDB entry 1eag

View 1eag on RCSB PDB site
Description: Secreted aspartic proteinase (SAP2) from Candida albicans complexed with A70450
Class: hydrolase/hydrolase inhibitor
Keywords: sap2, candida albicans, hydrolase-hydrolase inhibitor complex, aspartic protease
Deposited on 1996-05-31, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartic proteinase (sap2 gene product)
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eaga_
  • Heterogens: A70, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eagA (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
    qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaaslqgddgqpydkcqllfdv
    ndanilgdnflrsayivydlddneislaqvkytsassisalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eagA (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
    qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaasldgqpydkcqllfdvnda
    nilgdnflrsayivydlddneislaqvkytsassisalt