PDB entry 1eac

View 1eac on RCSB PDB site
Description: atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Class: dihydrolipoamide acetyltransferase
Keywords: dihydrolipoamide acetyltransferase
Deposited on 1992-12-16, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoyl-transacetylase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10802 (0-242)
      • conflict (63)
    Domains in SCOPe 2.03: d1eaca_
  • Heterogens: CAO, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eacA (A:)
    ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
    avakkagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
    vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
    pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
    ill