PDB entry 1ea7

View 1ea7 on RCSB PDB site
Description: sphericase
Class: hydrolase
Keywords: hydrolase, serine protease, sphericase, subtilisin like protease
Deposited on 2001-07-10, released 2002-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.93 Å
R-factor: 0.097
AEROSPACI score: 1.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: BACILLUS SPHAERICUS [TaxId:1421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ea7a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ea7A (A:)
    rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
    innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
    rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
    galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
    ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
    asgfgfarvq