PDB entry 1ea2

View 1ea2 on RCSB PDB site
Description: Pseudoreversion of the Catalytic Activity of Y14F by the Additional Tyrosine-to-Phenylalanine Substitution(s) in the Hydrogen Bond Network of Delta-5-3-Ketosteroid Isomerase from Pheudomonas putida Biotype B
Class: isomerase
Keywords: isomerase, ketosteroid isomerase
Deposited on 2000-11-03, released 2001-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (15)
    Domains in SCOPe 2.06: d1ea2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ea2A (A:)
mnlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >1ea2A (A:)
nlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv