PDB entry 1ea2

View 1ea2 on RCSB PDB site
Description: pseudoreversion of the catalytic activity of y14f by the additional tyrosin-to-phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b
Class: isomerase
Keywords: ketosteroid isomerase
Deposited on 2000-11-03, released 2001-11-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-5-3-ketosteroid isomerase.
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (15)
    Domains in SCOP 1.73: d1ea2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ea2A (A:)
mnlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >1ea2A (A:)
nlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv