PDB entry 1ea1

View 1ea1 on RCSB PDB site
Description: Cytochrome P450 14 alpha-sterol demethylase (CYP51) from Mycobacterium tuberculosis in complex with fluconazole
Class: oxidoreductase
Keywords: oxidoreductase, cytochrome p450, 14 alpha-sterol demethylase, azole inhibitors
Deposited on 2000-11-02, released 2000-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 51-like rv0764c
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: CYP51 OR RV0764C OR MTCY369.09C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ea1a_
  • Heterogens: HEM, TPF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ea1A (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpacvryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ea1A (A:)
    avalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshaneff
    fragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqvr
    rmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayv
    dpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprfs
    adeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalr
    qipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdp
    hdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqp
    pesyrndhskmvvqlaqpacvryrrrt