PDB entry 1ea0

View 1ea0 on RCSB PDB site
Description: alpha subunit of a. brasilense glutamate synthase
Class: oxidoreductase
Keywords: oxidoreductase, iron sulphur flavoprotein
Deposited on 2000-11-02, released 2001-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.25618
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ea0a1, d1ea0a2, d1ea0a3
  • Chain 'B':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ea0b1, d1ea0b2, d1ea0b3
  • Heterogens: OMT, FMN, AKG, F3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ea0A (A:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhlpkaisae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ea0A (A:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittdgli
    iggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwvqnt
    thldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmgdds
    piavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqtrll
    qlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrggath
    viltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavligvga
    ttvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyrggg
    nfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyrfrk
    sgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpvdev
    esitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkngdnw
    nsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhstpgv
    mlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadiili
    sgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiviaa
    mlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlftfla
    eevreilaglgfrslnevigrtdllhqvdldlnprlaqvdpggrnevpdtldarivadar
    plfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpghitirlrgtagqslgafa
    vqgiklevmgdandyvgkglsggtivvrpttsspletnkntiigntvlygatagklfaag
    qagerfavrnsgatvvvegcgsngceymtggtavilgrvgdnfaagmtggmayvydldds
    lplyindesvifqrievghyesqlkhlieehvtetqsrfaaeilndwarevtkfwqvvpk
    emlnrlevpvhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ea0B (B:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhlpkaisae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ea0B (B:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittdgli
    iggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwvqnt
    thldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmgdds
    piavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqtrll
    qlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrggath
    viltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavligvga
    ttvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyrggg
    nfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyrfrk
    sgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpvdev
    esitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkngdnw
    nsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhstpgv
    mlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadiili
    sgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiviaa
    mlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlftfla
    eevreilaglgfrslnevigrtdllhqvdldlnprlaqvdpggrnevpdtldarivadar
    plfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpghitirlrgtagqslgafa
    vqgiklevmgdandyvgkglsggtivvrpttsspletnkntiigntvlygatagklfaag
    qagerfavrnsgatvvvegcgsngceymtggtavilgrvgdnfaagmtggmayvydldds
    lplyindesvifqrievghyesqlkhlieehvtetqsrfaaeilndwarevtkfwqvvpk
    emlnrlevpvhl