PDB entry 1e9y

View 1e9y on RCSB PDB site
Description: crystal structure of helicobacter pylori urease in complex with acetohydroxamic acid
Class: hydrolase
Keywords: hydrolase, dodecamer
Deposited on 2000-11-01, released 2001-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease subunit alpha
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14916 (0-237)
      • conflict (169)
    Domains in SCOPe 2.07: d1e9ya1, d1e9ya2
  • Chain 'B':
    Compound: urease subunit beta
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69996 (0-568)
      • modified residue (218)
      • conflict (323)
      • conflict (354)
      • conflict (521)
      • conflict (530)
    Domains in SCOPe 2.07: d1e9yb1, d1e9yb2
  • Heterogens: HAE, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9yA (A:)
    mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe
    grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangklvpgelflknediti
    negkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkrldiaagtavrfepge
    eksvelidiggnrrifgfnalvdrqadneskkialhrakergfhgaksddnyvktike
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9yB (B:)
    mkkisrkeyvsmygpttgdkvrlgdtdliaevehdytiygeelkfgggktlregmsqsnn
    pskeeldliitnalivdytgiykadigikdgkiagigkggnkdmqdgvknnlsvgpatea
    lageglivtaggidthihfispqqiptafasgvttmigggtgpadgtnattitpgrrnlk
    wmlraaeeysmnlgflakgnasndasladqieagaigfkihedwgttpsainhaldvadk
    ydvqvaihtdtlneagcvedtmaaiagrtmhtfhtegaggghapdiikvagehnilpast
    nptipftvnteaehmdmlmvchhkdksikedvqfadsrirpqtiaaedtlhdmgafsits
    sdsqamgrvgevitrtwqtadknkkefgrlkeekgdndnfrikrylskytinpaiahgis
    eyvgsvevgkvadlvlwspaffgvkpnmiikggfialsqmgdanasiptpqpvyyremfa
    hhgkakydanitfvsqaaydkgikeelglerqvlpvkncrnvtkkdmqfnnttahievnp
    etyhvfvdgkevtskpankvslaqlfsif