PDB entry 1e9x

View 1e9x on RCSB PDB site
Description: Cytochrome P450 14 alpha-sterol demethylase (CYP51) from Mycobacterium tuberculosis in complex with 4-phenylimidazole
Class: oxidoreductase
Keywords: oxidoreductase, cytochrome p450, 14 alpha-sterol demethylase, azole inhibitors
Deposited on 2000-10-30, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 51-like rv0764c
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: CYP51 OR RV0764C OR MTCY369.09C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77901 (0-End)
    • PDB 1E9X
    Domains in SCOPe 2.07: d1e9xa_
  • Heterogens: HEM, PIM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9xA (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpacvryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9xA (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpacvryrrrt