PDB entry 1e9v

View 1e9v on RCSB PDB site
Description: xenon bound in hydrophobic channel of hybrid cluster protein from desulfovibrio vulgaris
Class: oxidoreductase
Keywords: oxidoreductase, cubane, iron sulfur, thiocysteine, prismane, hydrophobic cavity, s-mercaptocysteine, fuscoredoxin
Deposited on 2000-10-27, released 2001-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.161
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxylamine reductase
    Species: DESULFOVIBRIO VULGARIS [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9va_
  • Heterogens: FSO, SF4, XE, EDO, ACY, GOL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9vA (A:)
    mfcfqcqetakntgctvkgmcgkpeetanlqdllifvlrgiaiygeklkelgqpdrsndd
    fvlqglfatitnanwddarfeamiseglarrdklrnaflavykakngkdfseplpeaatw
    tgdstafaekaksvgilatenedvrslrelliiglkgvaayaehaavlgfrkteidefml
    ealasttkdlsvdemvalvmkaggmavttmalldeantttygnpeitqvnigvgknpgil
    isghdlkdmaellkqtegtgvdvythgemlpanyypafkkyphfvgnyggswwqqnpefe
    sfngpillttnclvplkkentyldrlyttgvvgyegakhiadrpaggakdfsaliaqakk
    cpppveietgsivggfahhqvlaladkvveavksgaikrfvvmagcdgrqksrsyyteva
    enlpkdtviltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgldd
    indlpvsydiawyeqkavavllallflgvkgirlgptlpaflspnvakvlvenfnikpig
    tvqddiaammagk