PDB entry 1e9t

View 1e9t on RCSB PDB site
Description: High resolution solution structure of human intestinal trefoil factor
Class: cell motility factor
Keywords: intestinal trefoil factor, solution structure, trefoil domain, nmr spectroscopy, cell motility factor
Deposited on 2000-10-26, released 2000-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intestinal trefoil factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9tA (A:)
    eeyvglsanqcavpakdrvdcgyphvtpkecnnrgccfdsripgvpwcfkplqeaectf