PDB entry 1e9t

View 1e9t on RCSB PDB site
Description: High resolution solution structure of human intestinal trefoil factor
Class: cell motility factor
Keywords: intestinal trefoil factor, solution structure, trefoil domain, nmr spectroscopy, cell motility factor
Deposited on 2000-10-26, released 2000-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: intestinal trefoil factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07654 (0-58)
  Domains in SCOPe 2.08: d1e9ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e9tA (A:)
  eeyvglsanqcavpakdrvdcgyphvtpkecnnrgccfdsripgvpwcfkplqeaectf