PDB entry 1e9r

View 1e9r on RCSB PDB site
Description: bacterial conjugative coupling protein trwbdeltan70. trigonal form in complex with sulphate.
Class: coupling protein
Keywords: coupling protein, bacterial conjugation, f1-ATPase-like quaternary structure, ring helicases
Deposited on 2000-10-26, released 2001-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9ra_
  • Chain 'B':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9rb_
  • Chain 'D':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9rd_
  • Chain 'E':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9re_
  • Chain 'F':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9rf_
  • Chain 'G':
    Compound: conjugal transfer protein trwb
    Species: Escherichia coli [TaxId:562]
    Gene: TRWB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9rg_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9rA (A:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rA (A:)
    vgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatg
    tgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirn
    dydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfdd
    lrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnl
    fitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltk
    grkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeh
    everdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafvegt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9rB (B:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rB (B:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryalervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafv
    eg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e9rD (D:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rD (D:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdalervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e9rE (E:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rE (E:)
    gqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgt
    gksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirnd
    ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddl
    rgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlf
    itwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkg
    rkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehe
    verdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafvegt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e9rF (F:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rF (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e9rG (G:)
    lnsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvng
    atgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffne
    irndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiat
    fddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpng
    gnlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklaslada
    ltkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslsl
    geheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpl
    eikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9rG (G:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg