PDB entry 1e9q

View 1e9q on RCSB PDB site
Description: crystal structure of bovine cu zn sod - (1 of 3)
Class: oxidoreductase
Keywords: oxidoreductase, sod, enzyme, superoxide, asymmetry
Deposited on 2000-10-26, released 2000-12-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00442 (0-150)
      • conflict (2)
      • conflict (8)
      • conflict (88)
      • conflict (74)
      • conflict (133)
    Domains in SCOPe 2.05: d1e9qa_
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Domains in SCOPe 2.05: d1e9qb_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e9qA (A:)
atsavcvlsgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadsngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e9qB (B:)
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneeststgnagsrlacgvigiak