PDB entry 1e9p

View 1e9p on RCSB PDB site
Description: Crystal structure of bovine Cu, Zn SOD to 1.7 Angstrom (3 of 3)
Class: oxidoreductase
Keywords: oxidoreductase, sod, enzyme, superoxide, asymmetry
Deposited on 2000-10-25, released 2000-12-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: superoxide dismutase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00442 (0-150)
    • conflict (2)
    • conflict (8)
    • conflict (72)
    • conflict (88)
    • conflict (150)
  Domains in SCOPe 2.05: d1e9pa_
• Chain 'B':
  Compound: superoxide dismutase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00442 (0-150)
    • conflict (2)
    • conflict (8)
    • conflict (22)
    • conflict (72)
    • conflict (74)
    • conflict (133)
    • conflict (150)
  Domains in SCOPe 2.05: d1e9pb_
• Heterogens: CU, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e9pA (A:)
  atsavcvlsgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
  hfnplskkhggpsdeerhvgdlgnvtadsngvaivdivdplislsgeysiigrtmvvhek
  pddlgrggneestktgnagsrlacgvigias
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e9pB (B:)
  atsavcvlsgdgpvqgtihfeasgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
  hfnplskkhggpsdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
  pddlgrggneeststgnagsrlacgvigias