PDB entry 1e9n

View 1e9n on RCSB PDB site
Description: a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism
Class: DNA repair
Keywords: DNA repair, DNA repair endonuclease, base excision repair, abasic endonuclease, ape1, hap1, ref-1, alpha, beta sandwich
Deposited on 2000-10-24, released 2001-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APE1
    Database cross-references and differences (RAF-indexed):
    • PDB 1E9N
    • Uniprot P27695 (Start-317)
    Domains in SCOPe 2.07: d1e9na_
  • Chain 'B':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APE1
    Database cross-references and differences (RAF-indexed):
    • PDB 1E9N
    • Uniprot P27695 (Start-317)
    Domains in SCOPe 2.07: d1e9nb_
  • Heterogens: PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9nA (A:)
    mpkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpa
    tlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqyws
    apsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglv
    rleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgf
    gellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdski
    rskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9nA (A:)
    alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds
    fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk
    gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy
    fllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9nB (B:)
    mpkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpa
    tlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqyws
    apsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglv
    rleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgf
    gellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdski
    rskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9nB (B:)
    alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds
    fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk
    gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy
    fllshsllpalcdskirskalgsdhcpitlylal