PDB entry 1e9m

View 1e9m on RCSB PDB site
Description: ferredoxin vi from rhodobacter capsulatus
Deposited on 2000-10-24, released 2001-04-09
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-16, with a file datestamp of 2002-07-16.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1e9ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e9mA (A:)
akiifiehngtrheveakpgltvmeaardngvpgidadcggacacstchayvdpawvdkl
pkalptetdmidfayepnpatsrltcqikvtslldglvvhlpekqi