PDB entry 1e9m

View 1e9m on RCSB PDB site
Description: Ferredoxin VI from Rhodobacter Capsulatus
Class: iron-sulfur protein
Keywords: iron-sulfur protein, ferredoxin, [2fe-2s], bacterium, electron transport
Deposited on 2000-10-24, released 2001-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin vi
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Gene: FDXE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e9ma_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e9mA (A:)
akiifiehngtrheveakpgltvmeaardngvpgidadcggacacstchayvdpawvdkl
pkalptetdmidfayepnpatsrltcqikvtslldglvvhlpekqi