PDB entry 1e9l

View 1e9l on RCSB PDB site
Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site
Deposited on 2000-10-21, released 2001-03-01
The last revision prior to the SCOP 1.69 freeze date was dated 2001-06-07, with a file datestamp of 2001-06-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9lA (A:)
    yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
    glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
    pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
    qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
    vgfpayghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdap
    qevpyayqgnewvgydnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfplts
    tlkgdlnihsasckgpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9lA (A:)
    yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
    glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
    pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
    qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
    vgfpayghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdap
    qevpyayqgnewvgydnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfplts
    tlkgdlnihsas