PDB entry 1e9k

View 1e9k on RCSB PDB site
Description: The structure of the RACK1 interaction sites located within the unique N-terminal region of the cAMP-specific phosphodiesterase, PDE4D5.
Class: hydrolase
Keywords: hydrolase, camp-specific phosphodiesterase
Deposited on 2000-10-20, released 2001-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08499 (0-37)
  Domains in SCOPe 2.08: d1e9ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e9kA (A:)
  vpevdnphcpnpwlnedlvkslrenllqheksktarks