PDB entry 1e9j

View 1e9j on RCSB PDB site
Description: solution structure of the a-subunit of human chorionic gonadotropin [including a single glcnac residue at asn52 and asn78]
Class: glycoprotein
Keywords: glycoprotein, chorionic gonadotropin, hcg, xplor
Deposited on 2000-10-18, released 2002-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chorionic gonadotropin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01215 (0-91)
  Domains in SCOPe 2.08: d1e9ja_
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e9jA (A:)
  apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
  vaksynrvtvmggfkvenhtachcstcyyhks