PDB entry 1e9i

View 1e9i on RCSB PDB site
Description: enolase from e.coli
Class: lyase
Keywords: degradosome, lyase
Deposited on 2000-10-17, released 2001-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9ia1, d1e9ia2
  • Chain 'B':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9ib1, d1e9ib2
  • Chain 'C':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9ic1, d1e9ic2
  • Chain 'D':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e9id1, d1e9id2
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9iA (A:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iA (A:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9iB (B:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iB (B:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e9iC (C:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iC (C:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasedgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgfayq
    tkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakdagy
    tavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekapyng
    rkeik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9iD (D:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa