PDB entry 1e9f

View 1e9f on RCSB PDB site
Description: mutant human thymidylate kinase complexed with tmp and adp
Deposited on 2000-10-11, released 2001-10-11
The last revision prior to the SCOP 1.63 freeze date was dated 2001-10-11, with a file datestamp of 2001-10-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1e9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9fA (A:)
    rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgrargeleryengafqeralrcfhqlmkdttlnwkmvdas
    ksieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9fA (A:)
    rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakryengafqeralrcfhqlmkdttlnwkmvdasksieavhed
    irvlsedaiatatekplgelwk