PDB entry 1e9d

View 1e9d on RCSB PDB site
Description: Mutant human thymidylate kinase (F105Y) complexed with AZTMP and ADP
Class: transferase
Keywords: phosphotransferase, thymidylate kinase, p-loop, transferase
Deposited on 2000-10-10, released 2001-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E9D
      • engineered mutation (202)
      • engineered mutation (107)
      • conflict (186)
      • conflict (193)
      • conflict (210)
      • conflict (192)
      • conflict (185)
    • Uniprot P23919 (Start-214)
    Domains in SCOPe 2.07: d1e9da_
  • Heterogens: ATM, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9dA (A:)
    gshmaarrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaytgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkm
    vdasksieavhedirvlsedaiatatekplkelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9dA (A:)
    arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
    vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaytgakenfsldwckqpdv
    glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
    sieavhedirvlsedaiatatekplkelwk