PDB entry 1e9c

View 1e9c on RCSB PDB site
Description: mutant human thymidylate kinase complexed with tmp and appnp
Deposited on 2000-10-10, released 2001-10-11
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-11, with a file datestamp of 2001-10-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e9ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e9cA (A:)
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaytgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplkelwk