PDB entry 1e99

View 1e99 on RCSB PDB site
Description: human thymidylate kinase complexed with aztmp and adp
Deposited on 2000-10-10, released 2001-10-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-05, with a file datestamp of 2001-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e99A (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
    ieavhedirvlsedaiatatekplgelwk