PDB entry 1e99

View 1e99 on RCSB PDB site
Description: Human thymidylate kinase complexed with AZTMP and ADP
Class: transferase
Keywords: phosphotransferase, thymidylate kinase, p-loop, transferase
Deposited on 2000-10-10, released 2001-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E99
      • engineered mutation (202)
      • conflict (185)
      • conflict (192)
      • conflict (186)
      • conflict (193)
    • Uniprot P23919 (Start-214)
    Domains in SCOPe 2.08: d1e99a_
  • Heterogens: ATM, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e99A (A:)
    gshmaarrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkm
    vdasksieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e99A (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
    ieavhedirvlsedaiatatekplgelwk