PDB entry 1e98

View 1e98 on RCSB PDB site
Description: Wild type human thymidylate kinase complexed with AZTMP and ADP
Class: transferase
Keywords: phosphotransferase, transferase, p-loop
Deposited on 2000-10-10, released 2001-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23919 (Start-214)
      • see remark 999 (185)
      • see remark 999 (192)
    Domains in SCOPe 2.07: d1e98a_
  • Heterogens: ADP, ATM, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e98A (A:)
    gshmaarrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkm
    vdaskrieavheeirvlsedairtatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e98A (A:)
    arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
    vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
    glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
    rieavheeirvlsedairtatekplgelwk