PDB entry 1e97

View 1e97 on RCSB PDB site
Description: crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f
Deposited on 2000-10-10, released 2001-10-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-05, with a file datestamp of 2001-10-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e97a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e97A (A:)
    nlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
    evnlsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e97A (A:)
    nlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqgl
    kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
    lsv