PDB entry 1e97

View 1e97 on RCSB PDB site
Description: crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f
Class: isomerase
Keywords: isomerase, ketosteroid isomerase, lbhb
Deposited on 2000-10-10, released 2001-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (15)
      • engineered mutation (31)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d1e97a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e97A (A:)
    mnlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e97A (A:)
    nlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqgl
    kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
    lsv