PDB entry 1e96

View 1e96 on RCSB PDB site
Description: structure of the rac/p67phox complex
Class: signaling protein
Keywords: signaling protein, signalling complex, gtpase, nadph oxidase, protein-protein complex, tpr motif
Deposited on 2000-10-10, released 2000-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15154 (0-End)
      • cloning artefact (0)
      • engineered (60)
    Domains in SCOPe 2.06: d1e96a1, d1e96a2
  • Chain 'B':
    Compound: neutrophil cytosol factor 2 (ncf-2) tpr domain, residues 1-203
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e96b_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e96A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e96A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e96B (B:)
    mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
    trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
    cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
    klfrpnerqvaqlakkdylgkat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e96B (B:)
    slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
    rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
    evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
    lfrpn