PDB entry 1e96

View 1e96 on RCSB PDB site
Description: structure of the rac/p67phox complex
Deposited on 2000-10-10, released 2000-11-17
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1e96a_
  • Chain 'B':
    Domains in SCOP 1.67: d1e96b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e96A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e96A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e96B (B:)
    mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
    trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
    cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
    klfrpnerqvaqlakkdylgkat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e96B (B:)
    slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
    rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
    evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
    lfrpn