PDB entry 1e94

View 1e94 on RCSB PDB site
Description: hslv-hslu from e.coli
Class: chaperone
Keywords: chaperone, hslvu, clpqy, aaa-ATPase, ATP-dependent proteolysis, proteasome
Deposited on 2000-10-07, released 2000-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2543
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e94a_
  • Chain 'B':
    Compound: heat shock protein hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e94b_
  • Chain 'C':
    Compound: heat shock protein hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e94c_
  • Chain 'D':
    Compound: heat shock protein hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e94d_
  • Chain 'E':
    Compound: heat shock protein hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32168 (7-448)
    • PDB 1E94 (Start-6)
    Domains in SCOPe 2.06: d1e94e1, d1e94e2
  • Chain 'F':
    Compound: heat shock protein hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32168 (7-448)
    • PDB 1E94 (Start-6)
    Domains in SCOPe 2.06: d1e94f1, d1e94f2
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e94A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e94B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e94C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e94D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e94E (E:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94E (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e94F (F:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94F (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieikqkar
    klkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsr
    egvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqa
    lttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarr
    lhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil